PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00357.2
Common NameAMTR_s00357p00009370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family TCP
Protein Properties Length: 74aa    MW: 8161.31 Da    PI: 9.7888
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00357.2genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP72.21.6e-222611170
                                     TCP 11 ihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70
                                            ++T++g+Rd R Rlsa++a++f+dLq +LG+ + sk ++WL++ a+ ai+el++ ++ ++
  evm_27.model.AmTr_v1.0_scaffold00357.2  2 VCTAKGLRDQRFRLSAHTAIEFYDLQVSLGYNRSSKGVDWLITRANSAIDELAKPPTWQP 61
                                            7***************************************************99855544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136920.807153IPR017887Transcription factor TCP subgroup
PfamPF036343.5E-20255IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 74 aa     Download sequence    Send to blast
MVCTAKGLRD QRFRLSAHTA IEFYDLQVSL GYNRSSKGVD WLITRANSAI DELAKPPTWQ  60
PTTVKPPKPT TGE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006840106.13e-35PREDICTED: transcription factor TCP3
SwissprotQ8LPR57e-23TCP4_ARATH; Transcription factor TCP4
TrEMBLW1NTM02e-49W1NTM0_AMBTC; Uncharacterized protein
STRINGGSMUA_Achr7P13980_0018e-23(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15030.33e-22TCP family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]